DDAH1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330785
- Bilder (5)
| Artikelname: | DDAH1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330785 |
| Hersteller Artikelnummer: | orb330785 |
| Alternativnummer: | BYT-ORB330785-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human DDAH1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti DDAH antibody, anti FLJ21264 antibody, anti FLJ25539 antibody |
| Rabbit polyclonal antibody to DDAH1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 31kDa |
| NCBI: | 036269 |
| UniProt: | O94760 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT |
| Target-Kategorie: | DDAH1 |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 0.5 ug/ml. |
|
|
Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 3.0 ug/ml. |
|
|
Kidney |
|
|
WB Suggested Anti-DDAH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Liver. |
Produktgarantie und fachkundiger Support
