UCHL1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB331010
| Artikelname: |
UCHL1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB331010 |
| Hersteller Artikelnummer: |
orb331010 |
| Alternativnummer: |
BYT-ORB331010-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti-Epididymis luminal protein 117 antibody, anti-HEL 117 antibody, anti-HEL S 53 antibody, anti-NDGOA antibody, anti-Neuron cytoplasmic protein 9.5 antibody, anti-Park 5 antibody, anti-PARK5 antibody, anti-PGP 9.5 antibody, anti-PGP9.5 antibody, anti-PGP95 antibody, anti-Protein gene product 9.5 antibody, anti-Ubiquitin C terminal esterase L1 antibody, anti-Ubiquitin C terminal hydrolase antibody, anti-Ubiquitin C terminal hydrolase L1 antibody, anti-Ubiquitin carboxyl terminal esterase L1 antibody, anti-Ubiquitin thioesterase L1 antibody, anti-Ubiquitin thiolesterase antibody, anti-UCH-L1 antibody, anti-UCHL1 antibody, anti-UCHL 1 antibody |
| Rabbit polyclonal antibody to PGP9.5 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
25kDa |
| NCBI: |
004172 |
| UniProt: |
P09936 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC |
| Target-Kategorie: |
UCHL1 |
![]()
|
orb331010 |
![]()
|
orb331010 |
![]()
|
orb331010 |
![]()
|
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. UCHL1 is supported by BioGPS gene expression data to be expressed in 721_B. |
![]()
|
WB Suggested Anti-UCHL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain. |
