The immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1
Konjugation:
Unconjugated
Alternative Synonym:
Anti-CO1A1_HUMAN antibody, anti-Collagen I antibody, anti-COL1A1 antibody, anti-COL1A2 antibody, anti-Collagen type I alpha 1 antibody, anti-Collagen type I alpha 2 antibody
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS
Target-Kategorie:
COL1A1
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~31 kDa.
Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.