EGR2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB333122
- Bilder (7)
| Artikelname: | EGR2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB333122 |
| Hersteller Artikelnummer: | orb333122 |
| Alternativnummer: | BYT-ORB333122-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC-P, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti CMT1D antibody, anti CMT4E antibody, anti DKFZp686J1957 antibody, anti FLJ14547 antibody, anti KROX20 antibody, anti AT591 antibody |
| Rabbit polyclonal antibody to EGR2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 50kDa |
| NCBI: | 000390 |
| UniProt: | P11161 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG |
| Target-Kategorie: | EGR2 |
|
|
Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml. |
|
|
Human Intestine |
|
|
Rabbit Anti-EGR2 Antibody, Paraffin Embedded Tissue: Human bronchiole epithelium, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung. |
Produktgarantie und fachkundiger Support
