Human BTN3A2 protein

Artikelnummer: BYT-ORB358073
Artikelname: Human BTN3A2 protein
Artikelnummer: BYT-ORB358073
Hersteller Artikelnummer: orb358073
Alternativnummer: BYT-ORB358073-20,BYT-ORB358073-100,BYT-ORB358073-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: BT3.2, BT3.3, BT3A2_HUMAN, BTF4, BTN3A 2, BTN3A2, Butyrophilin protein, Butyrophilin subfamily 3 member A2, Butyrophilin, subfamily 3, member A2, CD277, FLJ40011
This Human BTN3A2 protein spans the amino acid sequence from region 30-248aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.6 kDa
UniProt: P78410
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of Extracellular of His-SUMO-tag and expression region is 30-248aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.