Human C5 protein

Artikelnummer: BYT-ORB358075
Artikelname: Human C5 protein
Artikelnummer: BYT-ORB358075
Hersteller Artikelnummer: orb358075
Alternativnummer: BYT-ORB358075-20,BYT-ORB358075-100,BYT-ORB358075-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
This Human C5 protein spans the amino acid sequence from region 678-751aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.3 kDa
UniProt: P01031
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of C5a anaphylatoxin chain of His-SUMO-tag and expression region is 678-751aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.