Mouse Camk2n1 protein

Artikelnummer: BYT-ORB358077
Artikelname: Mouse Camk2n1 protein
Artikelnummer: BYT-ORB358077
Hersteller Artikelnummer: orb358077
Alternativnummer: BYT-ORB358077-20,BYT-ORB358077-100,BYT-ORB358077-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: calcium/calmodulin-dependent protein kinase II inhibitor alpha , mCaMKIINalpha
This Mouse Camk2n1 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.5 kDa
UniProt: Q6QWF9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-SUMO-tag and expression region is 1-78aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.