Bovine CD8A protein

Artikelnummer: BYT-ORB358079
Artikelname: Bovine CD8A protein
Artikelnummer: BYT-ORB358079
Hersteller Artikelnummer: orb358079
Alternativnummer: BYT-ORB358079-20,BYT-ORB358079-100,BYT-ORB358079-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CD8a
This Bovine CD8A protein spans the amino acid sequence from region 26-189aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 33.9 kDa
UniProt: P31783
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bos taurus (Bovine)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: Full length of Extracellular of His-SUMO-tag and expression region is 26-189aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.