Rat Gsta1 protein

Artikelnummer: BYT-ORB358094
Artikelname: Rat Gsta1 protein
Artikelnummer: BYT-ORB358094
Hersteller Artikelnummer: orb358094
Alternativnummer: BYT-ORB358094-20,BYT-ORB358094-100,BYT-ORB358094-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GST 1-1, GST 1a-1a, GST A1-1, GST B, Glutathione S-transferase Ya-1 , GST Ya1, Ligandin
This Rat Gsta1 protein spans the amino acid sequence from region 2-222aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 41.5 kDa
UniProt: P00502
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of His-SUMO-tag and expression region is 2-222aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.