Human IDUA protein

Artikelnummer: BYT-ORB358097
Artikelname: Human IDUA protein
Artikelnummer: BYT-ORB358097
Hersteller Artikelnummer: orb358097
Alternativnummer: BYT-ORB358097-20,BYT-ORB358097-100,BYT-ORB358097-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IDUA, Alpha-L-iduronidase, EC 3.2.1.76
This Human IDUA protein spans the amino acid sequence from region 28-653aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 73.9 kDa
UniProt: P35475
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-tag and expression region is 28-653aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.