Human ITPKB protein

Artikelnummer: BYT-ORB358099
Artikelname: Human ITPKB protein
Artikelnummer: BYT-ORB358099
Hersteller Artikelnummer: orb358099
Alternativnummer: BYT-ORB358099-20,BYT-ORB358099-100,BYT-ORB358099-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Inositol 1,4,5-trisphosphate 3-kinase B , IP3 3-kinase B , IP3K B , InsP 3-kinase B
This Human ITPKB protein spans the amino acid sequence from region 442-946aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 72.5 kDa
UniProt: P27987
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 442-946aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.