Human MAPK13 protein

Artikelnummer: BYT-ORB358103
Artikelname: Human MAPK13 protein
Artikelnummer: BYT-ORB358103
Hersteller Artikelnummer: orb358103
Alternativnummer: BYT-ORB358103-20,BYT-ORB358103-100,BYT-ORB358103-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Mitogen-activated protein kinase p38 delta , MAP kinase p38 delta, Stress-activated protein kinase 4
This Human MAPK13 protein spans the amino acid sequence from region 1-365aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.1 kDa
UniProt: O15264
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-365aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.