Human NRG2 protein

Artikelnummer: BYT-ORB358111
Artikelname: Human NRG2 protein
Artikelnummer: BYT-ORB358111
Hersteller Artikelnummer: orb358111
Alternativnummer: BYT-ORB358111-20,BYT-ORB358111-100,BYT-ORB358111-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Divergent of neuregulin-1 , DON-1Neural- and thymus-derived activator for ERBB kinases , NTAK
This Human NRG2 protein spans the amino acid sequence from region 112-405aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 48.8 kDa
UniProt: O14511
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGIN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of Extracellular of His-SUMO-tag and expression region is 112-405aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.