Human TCN1 protein

Artikelnummer: BYT-ORB358128
Artikelname: Human TCN1 protein
Artikelnummer: BYT-ORB358128
Hersteller Artikelnummer: orb358128
Alternativnummer: BYT-ORB358128-20,BYT-ORB358128-100,BYT-ORB358128-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Haptocorrin Short name, HC Protein R Transcobalamin I Short name, TC I Short name, TCI
This Human TCN1 protein spans the amino acid sequence from region 24-433aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 61.6 kDa
UniProt: P20061
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 24-433aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.