Sheep TNF protein

Artikelnummer: BYT-ORB358129
Artikelname: Sheep TNF protein
Artikelnummer: BYT-ORB358129
Hersteller Artikelnummer: orb358129
Alternativnummer: BYT-ORB358129-20,BYT-ORB358129-100,BYT-ORB358129-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a
This Sheep TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.2 kDa
UniProt: P23383
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Ovis aries (Sheep)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
Anwendungsbeschreibung: Biological Origin: Ovis aries (Sheep). Application Notes: Full length of GST-tag and expression region is 78-234aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.