Human TNFSF12 protein

Artikelnummer: BYT-ORB358130
Artikelname: Human TNFSF12 protein
Artikelnummer: BYT-ORB358130
Hersteller Artikelnummer: orb358130
Alternativnummer: BYT-ORB358130-20,BYT-ORB358130-100,BYT-ORB358130-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: APO3 ligandTNF-related weak inducer of apoptosis , TWEAK
This Human TNFSF12 protein spans the amino acid sequence from region 43-249aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.9 kDa
UniProt: O43508
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of Extracellular domain of His-SUMO-tag and expression region is 43-149aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.