Human XRCC5 protein

Artikelnummer: BYT-ORB358134
Artikelname: Human XRCC5 protein
Artikelnummer: BYT-ORB358134
Hersteller Artikelnummer: orb358134
Alternativnummer: BYT-ORB358134-20,BYT-ORB358134-100,BYT-ORB358134-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 86KDA subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 2ATP-dependent DNA helicase II 80KDA subunitCTC box-binding factor 85KDA subunit , CTC85 , CTCBFDNA repair protein XR, CC5Ku80Ku86Lupus Ku autoantigen protein p86Nuclear factor IVThyroid-lupus autoantigen , TLAAX-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
This Human XRCC5 protein spans the amino acid sequence from region 251-455aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27.4 kDa
UniProt: P13010
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Partial of His-tag and expression region is 251-455aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.