Rat Dac g 4 protein

Artikelnummer: BYT-ORB358137
Artikelname: Rat Dac g 4 protein
Artikelnummer: BYT-ORB358137
Hersteller Artikelnummer: orb358137
Alternativnummer: BYT-ORB358137-20,BYT-ORB358137-100,BYT-ORB358137-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Major pollen allergen Dac g 4, allergen Dac g 4, Fragments
This Rat Dac g 4 protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 22.4 kDa
UniProt: P82946
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Dactylis glomerata (Orchard grass) (Cocks-foot grass)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP
Anwendungsbeschreibung: Biological Origin: Dactylis glomerata (Orchard grass) (Cocks-foot grass). Application Notes: Full length of His-SUMO-tag and expression region is 1-55aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.