Human BFRF3 protein

Artikelnummer: BYT-ORB358145
Artikelname: Human BFRF3 protein
Artikelnummer: BYT-ORB358145
Hersteller Artikelnummer: orb358145
Alternativnummer: BYT-ORB358145-20,BYT-ORB358145-100,BYT-ORB358145-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: SCP, BFRF3, Small capsomere-interacting protein
This Human BFRF3 protein spans the amino acid sequence from region 31-176aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.7 kDa
UniProt: P14348
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ
Anwendungsbeschreibung: Biological Origin: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4). Application Notes: Partial of His-SUMO-tag and expression region is 31-176aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.