Viral NP protein

Artikelnummer: BYT-ORB358146
Artikelname: Viral NP protein
Artikelnummer: BYT-ORB358146
Hersteller Artikelnummer: orb358146
Alternativnummer: BYT-ORB358146-20,BYT-ORB358146-100,BYT-ORB358146-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Nucleocapsid protein , Protein N
This Viral NP protein spans the amino acid sequence from region 488-739aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 33.1 kDa
UniProt: P18272
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
Anwendungsbeschreibung: Biological Origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus). Application Notes: Partial of His-SUMO-tag and expression region is 488-739aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.