Viral KP6 killer toxin protein

Artikelnummer: BYT-ORB358149
Artikelname: Viral KP6 killer toxin protein
Artikelnummer: BYT-ORB358149
Hersteller Artikelnummer: orb358149
Alternativnummer: BYT-ORB358149-20,BYT-ORB358149-100,BYT-ORB358149-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: KP6 killer toxin, Killer protein 6) [Cleaved into, KP6 killer toxin subunit alpha, VP10), KP6 killer toxin subunit beta, VP12.5)]
This Viral KP6 killer toxin protein spans the amino acid sequence from region 28-105aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.6 kDa
UniProt: P16948
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Ustilago maydis P6 virus (UmV6) (UmV-P6)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS
Anwendungsbeschreibung: Biological Origin: Ustilago maydis P6 virus (UmV6) (UmV-P6). Application Notes: Full length of KP6 killer toxin subunit alpha of His-SUMO-tag and expression region is 28-105aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.