Drosophila UbcD6 protein

Artikelnummer: BYT-ORB358152
Artikelname: Drosophila UbcD6 protein
Artikelnummer: BYT-ORB358152
Hersteller Artikelnummer: orb358152
Alternativnummer: BYT-ORB358152-20,BYT-ORB358152-100,BYT-ORB358152-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Ubiquitin carrier proteinUbiquitin-protein ligase
This Drosophila UbcD6 protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 33.2 kDa
UniProt: P25153
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Drosophila melanogaster (Fruit fly)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
Anwendungsbeschreibung: Biological Origin: Drosophila melanogaster (Fruit fly). Application Notes: Full length of His-SUMO-tag and expression region is 1-151aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.