Human E7 protein

Artikelnummer: BYT-ORB358159
Artikelname: Human E7 protein
Artikelnummer: BYT-ORB358159
Hersteller Artikelnummer: orb358159
Alternativnummer: BYT-ORB358159-20,BYT-ORB358159-100,BYT-ORB358159-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: E7Protein E7
This Human E7 protein spans the amino acid sequence from region 1-99aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27 kDa
UniProt: P36831
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Human papillomavirus type 52
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL
Anwendungsbeschreibung: Biological Origin: Human papillomavirus type 52. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.