Animal GFP protein

Artikelnummer: BYT-ORB358279
Artikelname: Animal GFP protein
Artikelnummer: BYT-ORB358279
Hersteller Artikelnummer: orb358279
Alternativnummer: BYT-ORB358279-1,BYT-ORB358279-100,BYT-ORB358279-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GFPGreen fluorescent protein
This Animal GFP protein spans the amino acid sequence from region 1-238aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.9 kDa
UniProt: P42212
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Aequorea victoria (Jellyfish)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Anwendungsbeschreibung: Biological Origin: Aequorea victoria (Jellyfish). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.