Insect Beta-mammal toxin Cn2 protein

Artikelnummer: BYT-ORB358283
Artikelname: Insect Beta-mammal toxin Cn2 protein
Artikelnummer: BYT-ORB358283
Hersteller Artikelnummer: orb358283
Alternativnummer: BYT-ORB358283-1,BYT-ORB358283-100,BYT-ORB358283-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Toxin II.9.2.2
This Insect Beta-mammal toxin Cn2 protein spans the amino acid sequence from region 17-82aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 9.6 kDa
UniProt: P01495
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Centruroides noxius (Mexican scorpion)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Anwendungsbeschreibung: Biological Origin: Centruroides noxius (Mexican scorpion). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.