Human Fusion glycoprotein F0 protein

Artikelnummer: BYT-ORB358287
Artikelname: Human Fusion glycoprotein F0 protein
Artikelnummer: BYT-ORB358287
Hersteller Artikelnummer: orb358287
Alternativnummer: BYT-ORB358287-1,BYT-ORB358287-100,BYT-ORB358287-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: FFusion glycoprotein F0, Protein F) [Cleaved into, Fusion glycoprotein F2, Interchain peptide, Fusion glycoprotein F2, Fusion glycoprotein F1]
This Human Fusion glycoprotein F0 protein spans the amino acid sequence from region 137-574aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 50.1 kDa
UniProt: O36634
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Human respiratory syncytial virus B (strain B1)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETVIEFQQKNSRLLEINREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKVQSNRVFCDTMNSLTLPSEVSLCNTDIFNSKY
Anwendungsbeschreibung: Biological Origin: Human respiratory syncytial virus B (strain B1). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.