Human S100A7A protein

Artikelnummer: BYT-ORB358302
Artikelname: Human S100A7A protein
Artikelnummer: BYT-ORB358302
Hersteller Artikelnummer: orb358302
Alternativnummer: BYT-ORB358302-1,BYT-ORB358302-100,BYT-ORB358302-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: S100 calcium-binding protein A15S100 calcium-binding protein A7-like 1S100 calcium-binding protein A7A
This Human S100A7A protein spans the amino acid sequence from region 2-101aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 13.2 kDa
UniProt: Q86SG5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.