Human FBXO3 protein

Artikelnummer: BYT-ORB358310
Artikelname: Human FBXO3 protein
Artikelnummer: BYT-ORB358310
Hersteller Artikelnummer: orb358310
Alternativnummer: BYT-ORB358310-1,BYT-ORB358310-100,BYT-ORB358310-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: F Box G - Domain 3, F box only protein 3, F box protein 3, F box protein FBX3, F-box only protein 3, FBA, FBX3, FBX3_HUMAN, FBXO3
This Human FBXO3 protein spans the amino acid sequence from region 1-471aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 56.6 kDa
UniProt: Q9UK99
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.Note: If you have any special requirement for the glycerol content, please remark when you place the order.If the delivery form is lyophilized powder, the
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.