Rat Podxl protein

Artikelnummer: BYT-ORB358312
Artikelname: Rat Podxl protein
Artikelnummer: BYT-ORB358312
Hersteller Artikelnummer: orb358312
Alternativnummer: BYT-ORB358312-1,BYT-ORB358312-100,BYT-ORB358312-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Podocalyxin-like protein 1 , PC , PCLP-1
This Rat Podxl protein spans the amino acid sequence from region 25-386aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.8 kDa
UniProt: Q9WTQ2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSVQPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSSDKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSASVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTEEFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKP
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.