Bacterial virE2 protein

Artikelnummer: BYT-ORB358313
Artikelname: Bacterial virE2 protein
Artikelnummer: BYT-ORB358313
Hersteller Artikelnummer: orb358313
Alternativnummer: BYT-ORB358313-1,BYT-ORB358313-100,BYT-ORB358313-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 63.5KDA virulence protein
This Bacterial virE2 protein spans the amino acid sequence from region 1-556aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 65.3 kDa
UniProt: P08062
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDPKAEGNGENITETAAGNVETSDFVNLKRQKREGVNSTGMSEIDMTGSQETPEHNMHGSPTHTDDLGPRLDADMLDSQSSHVSSSAQGNRSEVENELSNLFAKMALPGHDRRTDEYILVRQTGQDKFAGTTKCNLDHLPTKAEFNASCRLYRDGVGNYYPPPLAFERIDIPEQLAAQLHNLEPREQSKQCFQYKLEVWNRAHAEMGITGTDIFYQTDKNIKLDRNYKLRPEDRYIQTEKYGRREIQKRYEHQFQ
Anwendungsbeschreibung: Biological Origin: Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.