Bacterial groL protein

Artikelnummer: BYT-ORB358315
Artikelname: Bacterial groL protein
Artikelnummer: BYT-ORB358315
Hersteller Artikelnummer: orb358315
Alternativnummer: BYT-ORB358315-1,BYT-ORB358315-100,BYT-ORB358315-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GroEL protein,Protein Cpn60
This Bacterial groL protein spans the amino acid sequence from region 1-542aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 59.1 kDa
UniProt: A5VIE9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Lactobacillus reuteri (strain DSM 20016)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAKEIKFSEDARSAMLSGVDKLADTVKTTMGPKGRNVVLEQSYGTPTITNDGVTIAKSIELENQFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVNAGMKNVTSGANPVGIRRGIDKATEVAVEALKKMSHDVKTKDDIEQIASISAANPEVGKLIADAMEKVGHDGVITIEDSRGVDTSVDVVEGMSFDRGYMSQYMVTDNDKMEADLDNPYILITDKKISNIQDILPLLQSVVQEGRALLIIADDITGE
Anwendungsbeschreibung: Biological Origin: Lactobacillus reuteri (strain DSM 20016). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.