Human LHPP protein

Artikelnummer: BYT-ORB358323
Artikelname: Human LHPP protein
Artikelnummer: BYT-ORB358323
Hersteller Artikelnummer: orb358323
Alternativnummer: BYT-ORB358323-1,BYT-ORB358323-100,BYT-ORB358323-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: FLJ44846, FLJ46044, HDHD2B, hLHPP, lhpp, LHPP_HUMAN, Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
This Human LHPP protein spans the amino acid sequence from region 1-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 31.2 kDa
UniProt: Q9H008
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.