Mouse Il1f10 protein

Artikelnummer: BYT-ORB358327
Artikelname: Mouse Il1f10 protein
Artikelnummer: BYT-ORB358327
Hersteller Artikelnummer: orb358327
Alternativnummer: BYT-ORB358327-1,BYT-ORB358327-100,BYT-ORB358327-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL-1F10
This Mouse Il1f10 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 19.1 kDa
UniProt: Q8R459
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.