Fungi KAE1 protein

Artikelnummer: BYT-ORB358328
Artikelname: Fungi KAE1 protein
Artikelnummer: BYT-ORB358328
Hersteller Artikelnummer: orb358328
Alternativnummer: BYT-ORB358328-1,BYT-ORB358328-100,BYT-ORB358328-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Kinase-associated endopeptidase 1 N6-L-threonylcarbamoyladenine synthase Short name, t(6)A synthase t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1 tRNA threonylcarbamoyladenosine biosynthesis protein KAE1
This Fungi KAE1 protein spans the amino acid sequence from region 1-386aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.7 kDa
UniProt: P36132
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVNLNTIPPKNGRDYYIALGLEGSANKLGVGIVKHPLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGFLPRDTARHHRNWCIRLIKQALAEADIKSPTLDIDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCIGHIEMGREITKAQNPVVLYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNEPSPGYNIEQLAKKAPHKENLVELPYTVKGMDLSMSGILASIDLLAKDLFK
Anwendungsbeschreibung: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.