Rat SARAF protein

Artikelnummer: BYT-ORB358330
Artikelname: Rat SARAF protein
Artikelnummer: BYT-ORB358330
Hersteller Artikelnummer: orb358330
Alternativnummer: BYT-ORB358330-1,BYT-ORB358330-100,BYT-ORB358330-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66
This Rat SARAF protein spans the amino acid sequence from region 195-339aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 17.5 kDa
UniProt: Q96BY9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.