Human IL6R protein

Artikelnummer: BYT-ORB358335
Artikelname: Human IL6R protein
Artikelnummer: BYT-ORB358335
Hersteller Artikelnummer: orb358335
Alternativnummer: BYT-ORB358335-1,BYT-ORB358335-100,BYT-ORB358335-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin 6 receptor, isoform CRA_a
This Human IL6R protein spans the amino acid sequence from region 20-365aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 40.5 kDa
UniProt: P08887
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.