Human SEPT2 protein

Artikelnummer: BYT-ORB358344
Artikelname: Human SEPT2 protein
Artikelnummer: BYT-ORB358344
Hersteller Artikelnummer: orb358344
Alternativnummer: BYT-ORB358344-1,BYT-ORB358344-100,BYT-ORB358344-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Neural precursor cell expressed developmentally down-regulated protein 5 Short name, NEDD-5
This Human SEPT2 protein spans the amino acid sequence from region 1-361aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 57.5 kDa
UniProt: Q15019
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.