Bacterial iagB protein

Artikelnummer: BYT-ORB358350
Artikelname: Bacterial iagB protein
Artikelnummer: BYT-ORB358350
Hersteller Artikelnummer: orb358350
Alternativnummer: BYT-ORB358350-1,BYT-ORB358350-100,BYT-ORB358350-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: iagB, STM2877Invasion protein IagB
This Bacterial iagB protein spans the amino acid sequence from region 20-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32 kDa
UniProt: P0CL15
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK
Anwendungsbeschreibung: Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.