Fungi HYP2 protein

Artikelnummer: BYT-ORB358352
Artikelname: Fungi HYP2 protein
Artikelnummer: BYT-ORB358352
Hersteller Artikelnummer: orb358352
Alternativnummer: BYT-ORB358352-1,BYT-ORB358352-100,BYT-ORB358352-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Hypusine-containing protein HP2 eIF-4D
This Fungi HYP2 protein spans the amino acid sequence from region 2-157aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 33 kDa
UniProt: P23301
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Anwendungsbeschreibung: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.