Reptile Omega-hexatoxin-Hv1a protein

Artikelnummer: BYT-ORB358353
Artikelname: Reptile Omega-hexatoxin-Hv1a protein
Artikelnummer: BYT-ORB358353
Hersteller Artikelnummer: orb358353
Alternativnummer: BYT-ORB358353-1,BYT-ORB358353-100,BYT-ORB358353-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Omega-atracotoxin-Hv1a Short name, AcTx-Hv1 Short name, Omega-AcTx-Hv1a
This Reptile Omega-hexatoxin-Hv1a protein spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 20.1 kDa
UniProt: P56207
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD
Anwendungsbeschreibung: Biological Origin: Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.