Plant Triticum aestivum protein

Artikelnummer: BYT-ORB358354
Artikelname: Plant Triticum aestivum protein
Artikelnummer: BYT-ORB358354
Hersteller Artikelnummer: orb358354
Alternativnummer: BYT-ORB358354-1,BYT-ORB358354-100,BYT-ORB358354-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glutenin, low molecular weight subunit 1D1
This Plant Triticum aestivum protein spans the amino acid sequence from region 24-307aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 48.5 kDa
UniProt: P10386
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Triticum aestivum (Wheat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRI
Anwendungsbeschreibung: Biological Origin: Triticum aestivum (Wheat). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.