Mouse Nkx2-2 protein

Artikelnummer: BYT-ORB358357
Artikelname: Mouse Nkx2-2 protein
Artikelnummer: BYT-ORB358357
Hersteller Artikelnummer: orb358357
Alternativnummer: BYT-ORB358357-1,BYT-ORB358357-100,BYT-ORB358357-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Homeobox protein NK-2 homolog B
This Mouse Nkx2-2 protein spans the amino acid sequence from region 1-273aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 46.1 kDa
UniProt: P42586
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSAS
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.