Viral HBV-D protein

Artikelnummer: BYT-ORB358361
Artikelname: Viral HBV-D protein
Artikelnummer: BYT-ORB358361
Hersteller Artikelnummer: orb358361
Alternativnummer: BYT-ORB358361-1,BYT-ORB358361-100,BYT-ORB358361-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: HBx Peptide X pX
This Viral HBV-D protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.7 kDa
UniProt: O93195
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
Anwendungsbeschreibung: Biological Origin: Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.