Fungi YPT1 protein

Artikelnummer: BYT-ORB358364
Artikelname: Fungi YPT1 protein
Artikelnummer: BYT-ORB358364
Hersteller Artikelnummer: orb358364
Alternativnummer: BYT-ORB358364-1,BYT-ORB358364-100,BYT-ORB358364-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1
This Fungi YPT1 protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.2 kDa
UniProt: P01123
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC
Anwendungsbeschreibung: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.