Bacterial amiF protein

Artikelnummer: BYT-ORB358368
Artikelname: Bacterial amiF protein
Artikelnummer: BYT-ORB358368
Hersteller Artikelnummer: orb358368
Alternativnummer: BYT-ORB358368-1,BYT-ORB358368-100,BYT-ORB358368-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Formamide amidohydrolase
This Bacterial amiF protein spans the amino acid sequence from region 1-337aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 53.2 kDa
UniProt: A4Z3G9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bradyrhizobium sp. (strain ORS278)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNGLGGLNKSEHGVVIGLVQLQLPVVVTKEDLAKQTEKIVWMVGKARRNLGTMDLVVFPEYSLHGLSMDTNPEIMCRLDGPEVAAFKQACIDNKIWGCFSIMEYNPDGNPYNSGLIIDSNGEIKLYYRKLHPWIPVEPWEPGDLGIPVIEGPRGAKIALIICHDGMFPEMARECAYKGAEIMIRTAGYTAPIRDSWRFTNQANAFQNLMVTANVCMCGSDGSFDSMGEGMIVNFDGSILAHGTTGRADEIITAEV
Anwendungsbeschreibung: Biological Origin: Bradyrhizobium sp. (strain ORS278). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bradyrhizobium sp. (strain ORS278) amiF.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bradyrhizobium sp. (strain ORS278) amiF.