Dog Mite group 2 allergen Lep d 2 protein

Artikelnummer: BYT-ORB358372
Artikelname: Dog Mite group 2 allergen Lep d 2 protein
Artikelnummer: BYT-ORB358372
Hersteller Artikelnummer: orb358372
Alternativnummer: BYT-ORB358372-1,BYT-ORB358372-100,BYT-ORB358372-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Lep d 1 Allergen Lep d I Allergen, Lep d 2
This Dog Mite group 2 allergen Lep d 2 protein spans the amino acid sequence from region 17-141aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.1 kDa
UniProt: P80384
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Lepidoglyphus destructor (Storage mite) (Glycyphagus destructor)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE
Anwendungsbeschreibung: Biological Origin: Lepidoglyphus destructor (Storage mite) (Glycyphagus destructor). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.