Bacterial lspL protein

Artikelnummer: BYT-ORB358380
Artikelname: Bacterial lspL protein
Artikelnummer: BYT-ORB358380
Hersteller Artikelnummer: orb358380
Alternativnummer: BYT-ORB358380-1,BYT-ORB358380-100,BYT-ORB358380-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: UDP-glucuronic acid epimerase
This Bacterial lspL protein spans the amino acid sequence from region 1-341aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 54.1 kDa
UniProt: O54067
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRYLITGTAGFIGFHVAKRLIDEGHFVVGFDGMTPYYDVTLKERRHAILQRSNGFKAVTAMLEDRAALDRAAELAEPEVIIHLAAQAGVRYSLENPKAYVDANLVGSWNMLELAKAIAPKHLMLASTSSIYGANEKIPFAEADRADEPMTLYAATKKSMELMAHSYAHLYKVPTTSFRFFTVYGPWGRPDMALFKFVDAIHNGRPIDIYGEGRMSRDFTYIDDLVESIVRLSHVPPSEENRVAPEKATDTLSRHA
Anwendungsbeschreibung: Biological Origin: Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.