Bacterial lptD protein

Artikelnummer: BYT-ORB358388
Artikelname: Bacterial lptD protein
Artikelnummer: BYT-ORB358388
Hersteller Artikelnummer: orb358388
Alternativnummer: BYT-ORB358388-1,BYT-ORB358388-100,BYT-ORB358388-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: lptD, imp, ostA, STY0108, t0096LPS-assembly protein LptD
This Bacterial lptD protein spans the amino acid sequence from region 73-169aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.9 kDa
UniProt: Q8Z9J6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Salmonella typhi
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS
Anwendungsbeschreibung: Biological Origin: Salmonella typhi. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.