Plant aac protein

Artikelnummer: BYT-ORB358403
Artikelname: Plant aac protein
Artikelnummer: BYT-ORB358403
Hersteller Artikelnummer: orb358403
Alternativnummer: BYT-ORB358403-20,BYT-ORB358403-100,BYT-ORB358403-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Aculeacin-A acylase small subunit Aculeacin-A acylase large subunit
This Plant aac protein spans the amino acid sequence from region 35-214aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 35.1 kDa
UniProt: P29958
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Actinoplanes utahensis
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA
Anwendungsbeschreibung: Biological Origin: Actinoplanes utahensis. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.