Human MAPKAP1 protein

Artikelnummer: BYT-ORB358414
Artikelname: Human MAPKAP1 protein
Artikelnummer: BYT-ORB358414
Hersteller Artikelnummer: orb358414
Alternativnummer: BYT-ORB358414-20,BYT-ORB358414-100,BYT-ORB358414-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Mitogen-activated protein kinase 2-associated protein 1 Stress-activated map kinase-interacting protein 1 Short name, SAPK-interacting protein 1 Short name, mSIN1
This Human MAPKAP1 protein spans the amino acid sequence from region 2-522aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 75 kDa
UniProt: Q9BPZ7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MAPKAP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MAPKAP1.